Peptid-Lexikon
VIP (Vasoaktives intestinales Peptid)
Vasoaktives intestinales Peptid aus 28 Aminosäuren, Neuropeptid der Glukagon/Sekretin-Familie.
| Substanzklasse | Peptid |
|---|---|
| Sequenz | HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 |
| Synonyme | Vasoactive Intestinal Peptide, Aviptadil |
Struktur
VIP ist ein C-terminal amidiertes Peptid aus 28 Aminosäuren. Es wirkt über die Rezeptoren VPAC1 und VPAC2 und kommt in Nervensystem, Darm, Lunge und Immunzellen vor.
Forschungsschwerpunkte
Untersucht werden Gefäßerweiterung, Sekretion im Darm, Bronchialfunktion, zirkadiane Rhythmen und entzündungshemmende Effekte auf Immunzellen.
Einordnung
Als Aviptadil wurde VIP in klinischen Studien geprüft; eine allgemeine Zulassung als Arzneimittel besteht in der EU nicht.
Literatur
- Migraine and neuropeptidesNeuropeptides, 2015 · PMID 26094101 · DOI 10.1016/j.npep.2015.03.006
- Vasoactive intestinal peptide/pituitary adenylate cyclase activating polypeptide, and their receptors and cancerCurr Opin Endocrinol Diabetes Obes, 2016 · PMID 26702849 · DOI 10.1097/MED.0000000000000218
- Pituitary adenylate cyclase-activating polypeptide/vasoactive intestinal peptide (Part 2): biology and clinical importance in central nervous system and inflammatory disordersCurr Opin Endocrinol Diabetes Obes, 2021 · PMID 33481421 · DOI 10.1097/MED.0000000000000621
- Neuropeptides and immunityAm Rev Respir Dis, 1987 · PMID 2446542 · DOI 10.1164/ajrccm/136.6_Pt_2.S48
- Vasoactive Intestinal Peptide-Secreting Tumors: A ReviewPancreas, 2019 · PMID 31609932 · DOI 10.1097/MPA.0000000000001402
